PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G115700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 270aa    MW: 28834.1 Da    PI: 7.7698
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G115700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.9e-161663148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l+  ++++G  +W++I++  g+ R++k+c++rw +yl
  Sevir.5G115700.1.p 16 KGLWSPEEDERLASHIARFGVSCWSSIPELAGLQRCGKSCRLRWMNYL 63
                        678*******************************************97 PP

2Myb_DNA-binding46.21.1e-1469111145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         rgr+++ E++l++ +++ lG+  W+ Ia++++ gR+++++k++w+
  Sevir.5G115700.1.p  69 RGRFSQHEEDLIIALHEALGNS-WSQIAARLP-GRSDNEIKNFWN 111
                         89******************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-23866IPR009057Homeodomain-like
PROSITE profilePS5129415.9681163IPR017930Myb domain
SuperFamilySSF466891.45E-2714110IPR009057Homeodomain-like
SMARTSM007172.1E-111565IPR001005SANT/Myb domain
PfamPF002491.0E-141663IPR001005SANT/Myb domain
CDDcd001671.43E-101963No hitNo description
PROSITE profilePS5129423.09164118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2567118IPR009057Homeodomain-like
SMARTSM007172.0E-1468116IPR001005SANT/Myb domain
PfamPF002491.0E-1269111IPR001005SANT/Myb domain
CDDcd001674.43E-1071111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRAHPCCSE EKKVRKGLWS PEEDERLASH IARFGVSCWS SIPELAGLQR CGKSCRLRWM  60
NYLRPDLKRG RFSQHEEDLI IALHEALGNS WSQIAARLPG RSDNEIKNFW NARLRKKLRQ  120
KEASSTAGSK EPAASHRRRG GGEGAGTHPA AVFNPLLPAN ADRPCPAGYV AGAAAGRSSY  180
DNDMWATGSA AATGGAVLAA ADVGRNAAAA ESVTPSPTST ASACTDAQAG CDDEFLKAMV  240
DDASILFGDF YLNSNHDGSI SFWEGHVFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261611827128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112118RLRKKLR
2113119LRKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4741396e-38AF474139.1 Oryza sativa typical P-type R2R3 Myb protein gene, partial cds.
GenBankAP0029126e-38AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
GenBankAP0033396e-38AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0149576e-38AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAY4593436e-38AY459343.1 Oryza sativa (japonica cultivar-group) clone CL018501.1 R2R3-MYB gene region.
GenBankCP0126096e-38CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968333.10.0PREDICTED: transcription factor MYB82-like
TrEMBLK3XKX70.0K3XKX7_SETIT; Uncharacterized protein
STRINGSi002550m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144481725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-61myb domain protein 86